Document And Entity Information Note To Financial Statement Details Textual Significant Accounting Policies November 2021 Share Repurchase Program [Member] Information on shares authorized to be repurchased during 2021. Note 3 - Revenue Recognition and Sales Commissions Debt Securities, Available-for-Sale [Table Text Block] Note 5 - Shareholders' Equity Note 6 - Earnings Per Share Note 7 - Marketable Securities Note 8 - Business Segments Note 3 - Revenue Recognition and Sales Commissions - Revenues Disaggregated By Revenue Source (Details) Note 5 - Shareholders' Equity - Summary of Stock-based Compensation Expense (Details) Note 6 - Earnings Per Share - Computation of Basic and Diluted Earnings Per Share (Details) Income Tax Disclosure [Text Block] Note 7 - Marketable Securities - Fair Value of Available for Sale Marketable Securities (Details) Unrealized (loss) gain on marketable securities Note 8 - Business Segments - Business Segment Information Based on Net Revenues and Operating Income (Details) Note 8 - Business Segments - Business Segment Information Based on Assets (Details) Stock-based compensation us-gaap_ShareBasedCompensation Other assets Notes To Financial Statements us-gaap_LiabilitiesCurrent Total current liabilities Notes To Financial Statements [Abstract] us-gaap_OtherThanTemporaryImpairmentLossDebtSecuritiesAvailableForSale Other-than-temporary Impairment Loss, Debt Securities, Available-for-sale, Total us-gaap_ShareBasedCompensationArrangementByShareBasedPaymentAwardEquityInstrumentsOtherThanOptionsGrantsInPeriodWeightedAverageGrantDateFairValue Share-based Compensation Arrangement by Share-based Payment Award, Equity Instruments Other than Options, Grants in Period, Weighted Average Grant Date Fair Value (in dollars per share) Foreign currency translation adjustments us-gaap_ShareBasedCompensationArrangementByShareBasedPaymentAwardEquityInstrumentsOtherThanOptionsGrantsInPeriod Share-Based Compensation Arrangement by Share-Based Payment Award, Equity Instruments Other than Options, Grants in Period (in shares) Proceeds from maturities of marketable securities Depreciation and amortization us-gaap_DepreciationDepletionAndAmortization Depreciation and amortization Corporate Debt Securities [Member] Other comprehensive income, net of taxes: Reconciliation of Revenue and Operating Profit Loss from Segments to Consolidated [Table Text Block] Tabular disclosure for reconciliation of revenue and operating profit (loss) from segments to consolidated. us-gaap_AssetsCurrent Total current assets Stockholders' Equity Note Disclosure [Text Block] Third Amendment [Member] Represents information regarding the Third Amendment to the credit agreement. us-gaap_PaymentsToAcquireMarketableSecurities Purchases of marketable securities Common stock, shares outstanding (in shares) hstm_LineOfCreditFacilityPercentageOfApplicableMarginForBorrowings Line of Credit Facility, Percentage of Applicable Margin for Borrowings Represents the applicable margin percentage for borrowings under a line of credit facility. Adjustments to reconcile net income to net cash provided by operating activities: Truist Bank [Member] Represents information regarding Truist Bank. Common stock, shares authorized (in shares) Swing Line Subfacility [Member] Represents information regarding a swing line subfacility. Accounts payable and accrued expenses Letter of Credit Subfacility [Member] Represents information regarding a letter of credit subfacility. Common stock, shares issued (in shares) Deferred revenue hstm_LineOfCreditFacilityIncreasedFacilitySizeDueToAccordionFeature Line of Credit Facility, Increased Facility Size Due to Accordion Feature Represents the increased line of credit facility size due to accordion feature. Common stock, par value (in dollars per share) hstm_DebtInstrumentCovenantMaximumFundedDebtLeverageRatio Debt Instrument, Covenant, Maximum Funded Debt Leverage Ratio Requirement for maximum funded debt ratio (consolidated debt/consolidated EBITDA) under the debt agreement. Common stock, no par value, 75,000 shares authorized; 30,518 and 31,327 shares issued and outstanding at March 31, 2022 and December 31, 2021, respectively hstm_DebtInstrumentCovenantInterestCoverageRatio Debt Instrument, Covenant, Interest Coverage Ratio Represents the minimum requirement for interest coverage ratio under the debt agreement. Statistical Measurement [Domain] Maximum [Member] Minimum [Member] Revolving Credit Facility [Member] Product and Service [Axis] Other prepaid expenses and other current assets Product and Service [Domain] Statistical Measurement [Axis] Recently Adopted Accounting Standards Policy [Policy Text Block] Disclosure of accounting policy for recently adopted accounting standards policy. Credit Facility [Axis] Credit Facility [Domain] us-gaap_PolicyTextBlockAbstract Accounting Policies Prepaid royalties, net of amortization Other Intangible Assets [Member] us-gaap_PaymentsForSoftware Payments associated with capitalized software development Accrued royalties us-gaap_PaymentsToAcquirePropertyPlantAndEquipment Purchases of property and equipment Effect of dilutive shares (in shares) Fair Value Hierarchy and NAV [Domain] Fair Value, Inputs, Level 2 [Member] us-gaap_ShareBasedCompensationArrangementByShareBasedPaymentAwardAwardVestingPeriod1 Share-based Compensation Arrangement by Share-based Payment Award, Award Vesting Period (Year) Weighted average shares of common stock outstanding: Reconciliation of Assets from Segment to Consolidated [Table Text Block] Not Conditioned on Shareholder Approval [Member] Related to not conditioned on shareholder approval. Fair Value Hierarchy and NAV [Axis] Not Based on 2022 Performance [Member] Related to not based on 2022 performance. Subject to Shareholder Approval [Member] Related to subject to shareholder approval. Current liabilities: Vesting [Axis] Vesting [Domain] Assets Total assets Accounts receivable - unbilled OPERATING ACTIVITIES: Customer-Related Intangible Assets [Member] Statement [Line Items] Accounts Receivable, Allowance for Credit Loss, Current Accounts receivable, net of allowance for doubtful accounts of $541 and $853 at March 31, 2022 and December 31, 2021, respectively Customer Contracts [Member] Deferred tax assets Finite-Lived Intangible Assets by Major Class [Axis] Finite-Lived Intangible Assets, Major Class Name [Domain] Share-Based Payment Arrangement, Expensed and Capitalized, Amount [Table Text Block] AOCI Attributable to Parent [Member] Shareholders’ equity: Marketable securities Other loss, net Segment Reporting Disclosure [Text Block] Business Description and Basis of Presentation [Text Block] Award Type [Domain] Award Date [Axis] Award Date [Domain] Current assets: Award Type [Axis] Net income Net income Net income Net income Accumulated amortization on intangible assets us-gaap_CashCashEquivalentsRestrictedCashAndRestrictedCashEquivalentsIncludingDisposalGroupAndDiscontinuedOperations Cash and cash equivalents at beginning of period Cash and cash equivalents at end of period Customer-related intangibles, net of accumulated amortization of $47,847 and $45,615 at March 31, 2022 and December 31, 2021, respectively Restricted Stock Units (RSUs) [Member] us-gaap_CashCashEquivalentsRestrictedCashAndRestrictedCashEquivalentsPeriodIncreaseDecreaseIncludingExchangeRateEffect Net (decrease) increase in cash and cash equivalents us-gaap_NetCashProvidedByUsedInFinancingActivities Net cash used in financing activities Commitments and contingencies Effect of exchange rate changes on cash and cash equivalents Workforce Solutions Operating income us-gaap_ContractWithCustomerLiabilityRevenueRecognized Contract with Customer, Liability, Revenue Recognized us-gaap_NetCashProvidedByUsedInOperatingActivities Net cash provided by operating activities us-gaap_NetCashProvidedByUsedInInvestingActivities Net cash used in investing activities Base Rate [Member] Consolidation Items [Domain] Deferred tax liabilities Accumulated amortization on property and equipment Property and equipment, net of accumulated depreciation of $19,270 and $17,999 at March 31, 2022 and December 31, 2021, respectively Goodwill Consolidation Items [Axis] Long-Term Debt, Type [Axis] Long-Term Debt, Type [Domain] us-gaap_PaymentsRelatedToTaxWithholdingForShareBasedCompensation Taxes paid related to net settlement of equity awards us-gaap_PaymentsOfDividendsCommonStock Payment of cash dividends us-gaap_CostsAndExpenses Total operating costs and expenses INVESTING ACTIVITIES: us-gaap_PaymentsForRepurchaseOfCommonStock Repurchases of common stock Operating costs and expenses: us-gaap_AvailableForSaleSecuritiesDebtSecurities Fair Value Net income per share: Retained Earnings [Member] Earnings Per Share [Text Block] Revenues, net Revenues, net Revenues Non-marketable equity investments Accounts payable and accrued expenses us-gaap_IncreaseDecreaseInAccountsPayableAndAccruedLiabilities Common Stock Including Additional Paid in Capital [Member] Share Repurchase Program [Domain] us-gaap_StockRepurchaseProgramAuthorizedAmount1 Stock Repurchase Program, Authorized Amount Income tax provision Income Tax Expense (Benefit), Total Short-Term Debt, Type [Axis] Equity Components [Axis] Share Repurchase Program [Axis] Short-Term Debt, Type [Domain] Equity Component [Domain] us-gaap_RevenueRemainingPerformanceObligationPercentage Revenue, Remaining Performance Obligation, Percentage us-gaap_RevenueRemainingPerformanceObligationExpectedTimingOfSatisfactionPeriod1 Revenue, Remaining Performance Obligation, Expected Timing of Satisfaction, Period (Month) us-gaap_RevenueRemainingPerformanceObligation Revenue, Remaining Performance Obligation, Amount Revenue, Remaining Performance Obligation, Expected Timing of Satisfaction, Start Date [Axis] us-gaap_IncomeLossFromContinuingOperationsBeforeIncomeTaxesExtraordinaryItemsNoncontrollingInterest Income before income tax provision Accrued royalties us-gaap_IncreaseDecreaseInRoyaltiesPayable Other general and administrative expenses us-gaap_LineOfCredit Long-term Line of Credit, Total Cash and cash equivalents Disaggregation of Revenue [Table Text Block] us-gaap_AllocatedShareBasedCompensationExpense Stock-based compensation expense Segment Reconciling Items [Member] Revenue from Contract with Customer [Text Block] Document Quarterly Report Amendment Flag Entity Incorporation, State or Country Code General and Administrative Expense [Member] Accounting Policies [Abstract] us-gaap_ComprehensiveIncomeNetOfTax Comprehensive income Document Transition Report City Area Code Entity Interactive Data Current Selling and Marketing Expense [Member] Deferred revenue us-gaap_IncreaseDecreaseInContractWithCustomerLiability Security Exchange Name us-gaap_CommonStockSharesOutstanding Balance (in shares) Balance (in shares) Title of 12(b) Security us-gaap_IncreaseDecreaseInOtherOperatingAssets Other assets Current Fiscal Year End Date us-gaap_DebtInstrumentBasisSpreadOnVariableRate1 Debt Instrument, Basis Spread on Variable Rate Cost of Sales [Member] us-gaap_IncreaseDecreaseInPrepaidDeferredExpenseAndOtherAssets Other prepaid expenses and other current assets Document Fiscal Period Focus Document Fiscal Year Focus Document Period End Date Income Statement Location [Axis] Income Statement Location [Domain] Entity File Number Entity Emerging Growth Company Document Type Entity Small Business Entity Shell Company Document Information [Line Items] Document Information [Table] us-gaap_IncreaseDecreaseInPrepaidRoyalties Prepaid royalties Entity Filer Category Entity Current Reporting Status Segments [Axis] Segments [Domain] Accumulated amortization on capitalized software development Variable Rate [Domain] Capitalized software development, net of accumulated amortization of $90,537 and $86,097 at March 31, 2022 and December 31, 2021, respectively Fed Funds Effective Rate Overnight Index Swap Rate [Member] Accounts and unbilled receivables us-gaap_IncreaseDecreaseInReceivables Eurodollar [Member] New Accounting Pronouncements [Text Block] Entire disclosure of accounting policy pertaining to new accounting pronouncements that may impact the entity's financial reporting. Includes, but is not limited to, quantification of the expected or actual impact. us-gaap_AntidilutiveSecuritiesExcludedFromComputationOfEarningsPerShareAmount Antidilutive Securities Excluded from Computation of Earnings Per Share, Amount (in shares) Variable Rate [Axis] Diluted (in shares) Weighted-average diluted shares (in shares) Stock-based compensation Statement of Comprehensive Income [Abstract] Entity Tax Identification Number Entity Central Index Key Entity Registrant Name Entity [Domain] Legal Entity [Axis] Statement [Table] Entity Address, Address Line One Statement of Financial Position [Abstract] Diluted (in dollars per share) Basic (in shares) Weighted-average shares outstanding (in shares) hstm_ShareBasedCompensationArrangementByShareBasedPaymentAwardIncrementalPerformancePercentageYearThree Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Three Represents the incremental increase in performance percentage, year 3. Entity Address, City or Town hstm_ShareBasedCompensationArrangementByShareBasedPaymentAwardIncrementalPerformancePercentageYearFour Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Four Represents the incremental increase in performance percentage, year 4. Cost of revenues (excluding depreciation and amortization) Amortization of deferred commissions Amortization of Deferred Sales Commissions us-gaap_EffectiveIncomeTaxRateContinuingOperations Effective Income Tax Rate Reconciliation, Percent, Total hstm_ShareBasedCompensationArrangementByShareBasedPaymentAwardIncrementalPerformancePercentageYearFive Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Five Represents the incremental increase in performance percentage, year 1. Entity Address, Postal Zip Code hstm_Sharebasedcompensationarrangementbysharebasedpaymentawardincrementalperformancepercentageyearone Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year One represents the incremental increase in performance percentage, year 1. Basic (in dollars per share) Entity Address, State or Province hstm_Sharebasedcompensationarrangementbysharebasedpaymentawardincrementalperformancepercentageyeartwo Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Two represents the incremental increase in performance percentage, year 2. us-gaap_StockRepurchasedDuringPeriodShares Stock Repurchased During Period, Shares (in shares) Repurchase of common stock (in shares) Statement of Cash Flows [Abstract] The 2022 March Issue [Member] Represents the 2022 issue for performance based RSUs. Performance Criteria Not Yet Determined [Member] represents performance criteria that has not yet been determined. Entity Common Stock, Shares Outstanding Performance Based Restricted Stock Units (RSUs) [Member] Represents the performance based restricted stock units. Two Thousand Twenty Two Performance [Member] Represents performance measures based on 2022 performance. Statement of Stockholders' Equity [Abstract] The 2018 June Issue [Member] Represents the 2018 June issue. Investments in Debt and Marketable Equity Securities (and Certain Trading Assets) Disclosure [Text Block] us-gaap_StockRepurchasedDuringPeriodValue Stock Repurchased During Period, Value Repurchase of common stock Income Statement [Abstract] Comprehensive income (loss) Total other comprehensive income March 2022 Share Repurchase Program [Member] Represents the shares repurchased under the March 2020 plan. Investments [Domain] Trading Symbol Investment Type [Axis] Local Phone Number us-gaap_TableTextBlock Notes Tables us-gaap_LineOfCreditFacilityMaximumBorrowingCapacity Line of Credit Facility, Maximum Borrowing Capacity us-gaap_LineOfCreditFacilityUnusedCapacityCommitmentFeePercentage Line of Credit Facility, Unused Capacity, Commitment Fee Percentage Common stock issued under stock plans, net of shares withheld for employee taxes (in shares) Provision for credit losses Accounts Receivable, Credit Loss Expense (Reversal) Common stock issued under stock plans, net of shares withheld for employee taxes FINANCING ACTIVITIES: Sales and marketing Other long term liabilities us-gaap_IncomeTaxReconciliationChangeInEnactedTaxRate Effective Income Tax Rate Reconciliation, Change in Enacted Tax Rate, Amount Line of Credit Facility, Lender [Domain] Deferred commissions Represents the amount associated with customer, asset, sales commission, noncurrent. Lender Name [Axis] us-gaap_LiabilitiesAndStockholdersEquity Total liabilities and shareholders’ equity hstm_StockRepurchasedAveragePricePerShare Stock Repurchased Average Price per Share (in dollars per share) Represents the stock repurchased average price per share. Product development Retained earnings Accumulated other comprehensive income Debt Disclosure [Text Block] Changes in operating assets and liabilities: Deferred revenue, noncurrent us-gaap_StockholdersEquity Total shareholders’ equity Balance Balance us-gaap_PaymentsToAcquireBusinessesNetOfCashAcquired Business combinations, net of cash acquired us-gaap_DisclosureTextBlockAbstract Notes to Financial Statements hstm_IncreaseDecreaseInDeferredCommissions Deferred commissions Represents the increase (decrease) in deferred commissions during the period. us-gaap_OtherNoncashIncomeExpense Other hstm_PaymentsToAcquireNonMarketableEquityInvestments Payments to acquire non-marketable equity investments Payments to acquire non-marketable equity investments during the period. Operating lease liability, noncurrent Class of Stock [Axis] hstm_GainLossOnNonMarketableEquityInvestments Loss on non-marketable equity investments Represents the amount of loss (gain) recognized during the period on non-marketable equity investments. Non-cash paid time off expense Represents the amount of non-cash paid time off expense recognized during the period. Schedule of Earnings Per Share, Basic and Diluted [Table Text Block] Subscription Services [Member] Represents information regarding subscription services. Professional Services [Member] Represents information regarding professional services. Product Development [Member] Represents information included in the Product Development line item. us-gaap_AvailableForSaleDebtSecuritiesAccumulatedGrossUnrealizedLossBeforeTax Unrealized Losses hstm_SalesCommissionsAmortizationTerm Sales Commissions, Amortization Term (Year) Represents the minimum amortization period for non-commensurate commissions. This minimum amortization period is the technological obsolescence period. Unrealized Gains Healthstream Workforce Solutions [Member] Represents information regarding the Workforce Solutions segment. Operating Segments [Member] Healthstream Provider Solutions [Member] Represents information regarding the Provider Solutions segment. Operating lease right of use assets, net Deferred income taxes Adjusted Cost